NAME
xcbinputgetdevicekeymapping - SYNOPSIS
#include
Request function xcbinputgetdevicekeymappingcookiet xcbinputgetdevicekeymapping(xcbconnectiont *conn, uint8t deviceid, xcbinputkeycodet firstkeycode, uint8t count); Reply datastructure typedef struct xcbinputgetdevicekeymappingreplyt { uint8t responsetype; uint8t xireplytype; uint16t sequence; uint32t length; uint8t keysymsperkeycode; uint8t pad0[23]; } xcbinputgetdevicekeymappingreplyt; Reply function xcbinputgetdevicekeymappingreplyt *xcbinputgetdevicekeymappingreply(xcbconnectiont *conn, xcbinputgetdevicekeymappingcookiet cookie, xcbgenericerrort **e); Reply accessors xcbkeysymt *xcbinputgetdevicekeymappingkeysyms(const xcbinputgetdevicekeymappingrequestt *reply); int xcbinputgetdevicekeymappingkeysymslength(const xcbinputgetdevicekeymappingreplyt *reply); xcbgenericiteratort xcbinputgetdevicekeymappingkeysymsend(const xcbinputgetdevicekeymappingreplyt *reply); REQUEST ARGUMENTS conn The XCB connection to X11. deviceid TODO: NOT YET DOCUMENTED. firstkeycode TODO: NOT YET DOCUMENTED. count TODO: NOT YET DOCUMENTED. REPLY FIELDS responsetype The type of this reply, in this case XCBINPUTGETDE‐ VICEKEYMAPPING. This field is also present in the xcbgenericreplyt and can be used to tell replies apart from each other. sequence The sequence number of the last request processed by the X11 server. length The length of the reply, in words (a word is 4 bytes). xireplytype TODO: NOT YET DOCUMENTED. keysymsperkeycode TODO: NOT YET DOCUMENTED. DESCRIPTION RETURN VALUE Returns an xcbinputgetdevicekeymappingcookiet. Errors have to be handled when calling the reply function xcbinputgetdevicekeymap‐ pingreply. If you want to handle errors in the event loop instead, use xcbin‐ putgetdevicekeymappingunchecked. See xcb-requests(3) for details. ERRORS This request does never generate any errors. SEE ALSO AUTHOR Generated from xinput.xml. Contact xcb@lists.freedesktop.org for cor‐ rections and improvements. X Version 11 libxcb 1.xcbinputgetdevicekeymapping(3)